01PePeptidesENHANCED

LL-37 available at Ascension Peptides Save 50% with code ENHANCED

Buy LL-37
RisingCOA VerifiedInjectable

LL-37

Antimicrobial peptide for immune defense and wound healing research

Half-life

~30 min

Typical Dose

Research-dependent

Format

Injectable

Purity

≥98%

LL-37 research vial

Overview

LL-37 is the only human cathelicidin, a 37-amino-acid antimicrobial peptide. Studied for its antimicrobial, immunomodulatory, and wound-healing properties.

Sequence & properties

Sequence, colored by side chain

[LL-37, 37 aa]
Basic (+)11Acidic (−)5Hydrophobic14Polar7

Length

37 aa

Avg mass

4,493.3 Da

Theoretical pI

11.35

Net charge (pH 7)

+6.0

Molecular formula: C205H340N60O53
Open in the property calculator

Mechanism

Disrupts microbial membranes through electrostatic and hydrophobic interactions. Also modulates immune cell recruitment and activation.

Researched benefits

  • Broad-spectrum antimicrobial activity
  • Immune modulation
  • Wound healing
  • Anti-biofilm effects

Frequently asked

What is LL-37?

LL-37 is the only human cathelicidin antimicrobial peptide, a 37-amino-acid fragment cleaved from the hCAP18 precursor. It is a component of innate immune defense found in neutrophils, epithelial cells, and skin.

How does LL-37 kill bacteria?

It is cationic and amphipathic, so it inserts into and disrupts negatively charged bacterial membranes. Because the mechanism is physical rather than enzymatic, resistance development is slower than with conventional antibiotics.

Does LL-37 do anything besides antimicrobial defense?

Yes. It is also chemotactic for neutrophils and monocytes, promotes angiogenesis, and modulates wound healing. These immunomodulatory roles are a large part of the current research interest.

Why is LL-37 not used systemically?

At higher concentrations it is cytotoxic to host cells as well as bacteria, and it is rapidly degraded by proteases in circulation. Research focuses on local and topical application rather than systemic administration.

Ready to start your research

Get LL-37 from Ascension Peptides

COA-verified, US-based, discreet shipping. Use code ENHANCED for 50% off your entire order.

Buy LL-37 now