01PePeptidesENHANCED

TB-500 (Thymosin Beta-4) available at Ascension Peptides Save 50% with code ENHANCED

Buy TB-500 (Thymosin Beta-4)
TrendingCOA VerifiedInjectable

TB-500 (Thymosin Beta-4)Research guide

Synthetic thymosin beta-4 fragment studied for muscle, tendon, and tissue regeneration

Half-life

~2-3 hours

Typical Dose

2-5mg twice weekly

Format

Injectable

Purity

≥98%

TB-500 (Thymosin Beta-4) research vial

Overview

TB-500 is a synthetic version of an active region of Thymosin Beta-4, a naturally occurring peptide. Studied for accelerating wound healing, muscle recovery, and cardiac repair.

Sequence & properties

Sequence, colored by side chain

SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Basic (+)9Acidic (−)11Hydrophobic11Polar12

Length

43 aa

Avg mass

4,921.5 Da

Theoretical pI

4.72

Net charge (pH 7)

-2.0

Molecular formula: C210H348N56O77SFull thymosin β4; marketed TB-500 is usually N-acetylated (about +42 Da). Values above are for the unmodified sequence.
Open in the property calculator

Mechanism

Promotes actin polymerization, cell migration, and angiogenesis. Modulates inflammation and supports tissue repair across multiple cell types.

Researched benefits

  • Muscle tissue repair
  • Tendon and ligament healing
  • Cardiac tissue regeneration research
  • Hair growth in animal studies
  • Anti-inflammatory effects
Bundle · Save Time

Wolverine Stack

BPC-157 10mg + TB-500 10mg — pre-mixed, research-ready

Partner price

$130

  • Single vial, single reconstitution
  • Proven 1:1 ratio from recovery protocols
  • Same-day US shipping · COA verified
Shop Wolverine Stack

Code ENHANCED applies at checkout

Bundle · Save Time

GLOW Blend

GHK-Cu + BPC-157 + TB-500 — the complete recovery + skin stack

Partner price

$160

  • Three proven compounds in one vial
  • Covers skin, tissue repair, and systemic healing
  • Premium formulation
Shop GLOW Blend

Code ENHANCED applies at checkout

Frequently asked

Is TB-500 the same as Thymosin Beta-4?

Not quite. Thymosin Beta-4 is the full 43-amino-acid protein. TB-500 is the synthetic fragment containing the actin-binding domain, the region responsible for most of the cell migration and repair activity. The fragment is smaller and more soluble.

TB-500 vs BPC-157 for tissue repair?

They work through different mechanisms and are often studied together. TB-500 acts on actin polymerization and cell migration; BPC-157 drives angiogenesis and growth factor upregulation. The pairing is common precisely because the pathways do not overlap.

Why do protocols describe a loading phase?

TB-500 research protocols often front-load administration for the first several weeks, then reduce frequency. The rationale is reaching tissue saturation quickly before moving to a maintenance schedule.

What is TB-500's half-life?

Reported plasma half-life is short, but the actin-binding activity is thought to persist in tissue longer than plasma clearance alone would suggest, which is the basis for less frequent dosing schedules.

Keep researching

Next steps for TB-500 (Thymosin Beta-4)

The compound page is the overview. Charts, certificates, and the vendor audit sit one click away.

Protocol

TB-500 (Thymosin Beta-4) dosage chart

Research dosing ranges, reconstitution math, and stacks for TB-500 (Thymosin Beta-4).

Open dosage chart

COA

Where to buy TB-500 (Thymosin Beta-4)

Lot-level HPLC records and vendor comparison before you pay.

Compare lab tests

Vendor

Ascension Peptides review

The COA audit and the ENHANCED 50% code for injectable research peptides.

Read the review

Ready to start your research

Get TB-500 (Thymosin Beta-4) from Ascension Peptides

COA-verified, US-based, discreet shipping. Use code ENHANCED for 50% off your entire order.

Buy TB-500 (Thymosin Beta-4) now